TG004641

From GPTWiki
Revision as of 17:39, 23 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H3N5F]ITEENVQNMNNAGDKWSAFLK.E (PE001768)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H3N5F (N27)
Mod(s)
Molecular Weight 7,309.219
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
72.194 71.297 145.157 1,459.250 5+ 1,773.040 4+ Y[pH3N4F] 21.7
72.194 71.297 145.157 1,459.250 5+ 1,736.526 4+ Y[pH3N4] 14.0
72.194 71.297 145.157 1,459.250 5+ 1,499.191 4+ Y[pNF] 8.3
72.194 71.297 145.157 1,459.250 5+ 1,685.756 4+ Y[pH3N3] 7.2
72.194 71.297 145.157 1,459.250 5+ 1,722.270 4+ Y[pH3N3F] 6.2
72.194 71.297 145.157 1,459.250 5+ 1,681.757 4+ Y[pH2N3F] 5.0

Spectra

14997;EThcD;71.649;14990;1459.258;Byonic:q-value=1.28e-16/GPS:MinICScore=31.912
14999;HCD;71.658;14990;1459.258;
15120;EThcD;72.184;15118;1459.258;Byonic:q-value=1.47e-06/GPS:MinICScore=64.196
15122;HCD;72.194;15118;1459.258;
15205;EThcD;72.555;15204;1459.261;Byonic:q-value=0.000136/GPS:MinICScore=105.114
15206;HCD;72.562;15204;1459.261;