TG004499

From GPTWiki
Revision as of 16:19, 18 May 2021 by Edwardsnj (talk | contribs)
Jump to navigation Jump to search
Peptide R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S2]YSCSYR.T (PE000229)
Sequence REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S2 (N28)
Mod(s) 57.021 (C31)
Molecular Weight 6,214.554
Charge 5+
Protein A1BG (P04217)
Spectrum File DataMS_UO1_SWATH_11202019_Erlich5
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum
Extraction OpenSWATH
Intensity 122.796
Score 1.749
FDR 0.6%

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
33.869 33.869 83.009 1,240.319 5+ 1,386.090 4+ Y[pH4N3S] 100.0
33.869 33.869 83.009 1,240.319 5+ 1,575.024 3+ Y[pH2N2] 71.0
33.869 33.869 83.009 1,240.319 5+ 1,629.041 3+ Y[pH3N2] 55.9
33.869 33.869 83.009 1,240.319 5+ 1,345.577 4+ Y[pH3N3S] 44.2
33.869 33.869 83.009 1,240.319 5+ 1,399.295 3+ Y[pN] 38.6
33.869 33.869 83.009 1,240.319 5+ 1,049.724 4+ Y[pN] 36.9
33.869 33.869 83.009 1,240.319 5+ 1,313.316 4+ Y[pH4N3] 36.3
33.869 33.869 83.009 1,240.319 5+ 1,750.752 3+ Y[pH4N3] 33.5
33.869 33.869 83.009 1,240.319 5+ 1,404.599 4+ Y[pH5N4] 15.0
33.869 33.869 83.009 1,240.319 5+ 1,521.006 3+ Y[pHN2] 14.4
33.869 33.869 83.009 1,240.319 5+ 1,477.373 4+ Y[pH5N4S] 13.2
33.869 33.869 83.009 1,240.319 5+ 1,696.734 3+ Y[pH3N3] 7.6
33.869 33.869 83.009 1,240.319 5+ 1,466.989 3+ Y[pN2] 7.3