Difference between revisions of "TG004499"
Jump to navigation
Jump to search
Line 4: | Line 4: | ||
|intensity=122.796 | |intensity=122.796 | ||
|mz1=1240.319 | |mz1=1240.319 | ||
− | |nrt=83. | + | |nrt=83.125 |
|ntransition=13 | |ntransition=13 | ||
|peptide=PE000229 | |peptide=PE000229 | ||
|prt=33.869 | |prt=33.869 | ||
|rt=33.869 | |rt=33.869 | ||
− | |score=1. | + | |score=1.734 |
|spectra=DataMS_UO1_SWATH_11202019_Erlich5 | |spectra=DataMS_UO1_SWATH_11202019_Erlich5 | ||
|transitions=TR007691;100.0,TR002115;71.0,TR002116;55.9,TR007694;44.2,TR002117;38.6,TR007692;36.9,TR007693;36.3,TR002118;33.5,TR017018;15.0,TR029945;14.4,TR009050;13.2,TR017016;7.6,TR017017;7.3 | |transitions=TR007691;100.0,TR002115;71.0,TR002116;55.9,TR007694;44.2,TR002117;38.6,TR007692;36.9,TR007693;36.3,TR002118;33.5,TR017018;15.0,TR029945;14.4,TR009050;13.2,TR017016;7.6,TR017017;7.3 | ||
|z1=5 | |z1=5 | ||
}} | }} |
Latest revision as of 15:01, 24 May 2021
Peptide | R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S2]YSCSYR.T (PE000229) |
---|---|
Sequence | REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR |
Glycans(s) | H5N4S2 (N28) |
Mod(s) | 57.021 (C31) |
Molecular Weight | 6,214.554 |
Charge | 5+ |
Protein | A1BG (P04217) |
Spectrum File | DataMS_UO1_SWATH_11202019_Erlich5 |
Method | Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS |
Analytical Fraction | SAX-ERLICH Enrichment |
Sample | Human Serum |
Extraction | OpenSWATH |
Intensity | 122.796 |
Score | 1.734 |
FDR | 0.6% |
Transitions
Exp. R.T. | Peak R.T. | Norm. R.T. | Prec. m/z | Prec. z | Prod. m/z | Prod. z | Label | %Int | |
---|---|---|---|---|---|---|---|---|---|
33.869 | 33.869 | 83.125 | 1,240.319 | 5+ | 1,386.090 | 4+ | Y[pH4N3S] | 100.0 | |
33.869 | 33.869 | 83.125 | 1,240.319 | 5+ | 1,575.024 | 3+ | Y[pH2N2] | 71.0 | |
33.869 | 33.869 | 83.125 | 1,240.319 | 5+ | 1,629.041 | 3+ | Y[pH3N2] | 55.9 | |
33.869 | 33.869 | 83.125 | 1,240.319 | 5+ | 1,345.577 | 4+ | Y[pH3N3S] | 44.2 | |
33.869 | 33.869 | 83.125 | 1,240.319 | 5+ | 1,399.295 | 3+ | Y[pN] | 38.6 | |
33.869 | 33.869 | 83.125 | 1,240.319 | 5+ | 1,049.724 | 4+ | Y[pN] | 36.9 | |
33.869 | 33.869 | 83.125 | 1,240.319 | 5+ | 1,313.316 | 4+ | Y[pH4N3] | 36.3 | |
33.869 | 33.869 | 83.125 | 1,240.319 | 5+ | 1,750.752 | 3+ | Y[pH4N3] | 33.5 | |
33.869 | 33.869 | 83.125 | 1,240.319 | 5+ | 1,404.599 | 4+ | Y[pH5N4] | 15.0 | |
33.869 | 33.869 | 83.125 | 1,240.319 | 5+ | 1,521.006 | 3+ | Y[pHN2] | 14.4 | |
33.869 | 33.869 | 83.125 | 1,240.319 | 5+ | 1,477.373 | 4+ | Y[pH5N4S] | 13.2 | |
33.869 | 33.869 | 83.125 | 1,240.319 | 5+ | 1,696.734 | 3+ | Y[pH3N3] | 7.6 | |
33.869 | 33.869 | 83.125 | 1,240.319 | 5+ | 1,466.989 | 3+ | Y[pN2] | 7.3 |