TG004364

From GPTWiki
Revision as of 16:51, 23 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N3F]FTTAPAICHDGK.A (PE001652)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H5N3F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 6,134.796
Charge 7+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
40.067 39.816 64.592 874.836 7+ 959.619 6+ Y[pH4N2F] 88.2
40.067 39.816 64.592 874.836 7+ 951.871 5+ Y[pN] 61.0
40.067 39.816 64.592 874.836 7+ 932.610 6+ Y[pH3N2F] 43.0
40.067 39.816 64.592 874.836 7+ 981.083 5+ Y[pNF] 22.8
40.067 39.816 64.592 874.836 7+ 1,189.587 4+ Y[pN] 16.5
40.067 39.816 64.592 874.836 7+ 935.276 6+ Y[pH4N2] 13.7
40.067 39.816 64.592 874.836 7+ 854.249 6+ Y[pHN2] 13.0
40.067 39.816 64.592 874.836 7+ 827.241 6+ Y[pN2] 12.1
40.067 39.816 64.592 874.836 7+ 908.267 6+ Y[pH3N2] 11.9
40.067 39.816 64.592 874.836 7+ 992.487 5+ Y[pN2] 10.7
40.067 39.816 64.592 874.836 7+ 853.971 7+ Y[pH5N3] 10.6
40.067 39.816 64.592 874.836 7+ 793.394 6+ Y[pN] 7.6
40.067 39.816 64.592 874.836 7+ 878.592 6+ Y[pHN2F] 7.2
40.067 39.816 64.592 874.836 7+ 1,089.719 5+ Y[pH3N2] 7.2
40.067 39.816 64.592 874.836 7+ 911.255 5+ Y[p] 5.4

Spectra

7986;EThcD;40.051;7984;874.840;Byonic:q-value=0.00104/GPS:MinICScore=72.100
7988;HCD;40.060;7984;874.840;