TG004344

From GPTWiki
Revision as of 16:57, 23 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N3F]FTTAPAICHDGK.A (PE001652)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H5N3F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 6,134.796
Charge 6+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
39.225 38.992 62.906 1,020.474 6+ 1,151.341 5+ Y[pH4N2F] 41.0
39.225 38.992 62.906 1,020.474 6+ 1,118.930 5+ Y[pH3N2F] 26.8
39.225 38.992 62.906 1,020.474 6+ 1,189.587 4+ Y[pN] 19.8
39.225 38.992 62.906 1,020.474 6+ 1,122.129 5+ Y[pH4N2] 14.0
39.225 38.992 62.906 1,020.474 6+ 993.465 6+ Y[pH4N3F] 13.3
39.225 38.992 62.906 1,020.474 6+ 1,089.719 5+ Y[pH3N2] 11.2
39.225 38.992 62.906 1,020.474 6+ 951.871 5+ Y[pN] 9.2
39.225 38.992 62.906 1,020.474 6+ 1,226.102 4+ Y[pNF] 7.7
39.225 38.992 62.906 1,020.474 6+ 992.487 5+ Y[pN2] 7.4
39.225 38.992 62.906 1,020.474 6+ 996.131 6+ Y[pH5N3] 5.3

Spectra

7678;EThcD;39.229;7673;1020.645;Byonic:q-value=1.54e-06/GPS:MinICScore=38.542
7680;HCD;39.238;7673;1020.645;