TG004259

From GPTWiki
Revision as of 17:47, 23 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6F]FTTAPAICHDGK.A (PE001617)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H7N6F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7,068.14
Charge 7+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
43.695 45.488 78.707 1,008.171 7+ 1,115.176 6+ Y[pH6N5F] 24.6
43.695 45.488 78.707 1,008.171 7+ 1,264.983 5+ Y[pH5N4F] 9.1
43.695 45.488 78.707 1,008.171 7+ 1,503.950 4+ Y[pH4N4] 5.5
43.695 45.488 78.707 1,008.171 7+ 1,088.167 6+ Y[pH5N5F] 5.5

Spectra

7948;EThcD;39.877;7946;1008.177;Byonic:q-value=4.89e-10/GPS:MinICScore=40.472
7950;HCD;39.887;7946;1008.177;