Difference between revisions of "TG004259"

From GPTWiki
Jump to navigation Jump to search
Line 4: Line 4:
 
|nrt=78.707
 
|nrt=78.707
 
|ntransition=4
 
|ntransition=4
|pepnrt=drop (+17.078)
+
|pepnrt=drop (+17.496)
 
|peptide=PE001617
 
|peptide=PE001617
 
|prt=45.488
 
|prt=45.488

Revision as of 18:18, 14 May 2021

Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6F]FTTAPAICHDGK.A (PE001617)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H7N6F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7,068.14
Charge 7+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
43.695 45.488 78.707 1,008.171 7+ 1,115.176 6+ Y[pH6N5F] 24.6
43.695 45.488 78.707 1,008.171 7+ 1,264.983 5+ Y[pH5N4F] 9.1
43.695 45.488 78.707 1,008.171 7+ 1,503.950 4+ Y[pH4N4] 5.5
43.695 45.488 78.707 1,008.171 7+ 1,088.167 6+ Y[pH5N5F] 5.5

Spectra

7948;EThcD;39.877;7946;1008.177;Byonic:q-value=4.89e-10/GPS:MinICScore=40.472
7950;HCD;39.887;7946;1008.177;