Difference between revisions of "TG004259"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{TransitionGroup |gphash=1f882809fb |mz1=1008.171 |nrt=78.707 |ntransition=4 |pepnrt=drop (+17.078) |peptide=PE001617 |prt=45.488 |rt=43.695 |scans=7948;EThcD;39.877;7946;100...")
 
Line 8: Line 8:
 
|prt=45.488
 
|prt=45.488
 
|rt=43.695
 
|rt=43.695
|scans=7948;EThcD;39.877;7946;1008.177;Byonic:q-value=4.89e-10/GPS:ICScore=48.347,7950;HCD;39.887;7946;1008.177;
+
|scans=7948;EThcD;39.877;7946;1008.177;Byonic:q-value=4.89e-10/GPS:MinICScore=40.472,7950;HCD;39.887;7946;1008.177;
 
|spectra=MS_50_Covid_spike_trypsin_new
 
|spectra=MS_50_Covid_spike_trypsin_new
 
|transitions=TR022782;24.6,TR022783;9.1,TR022784;5.5,TR022785;5.5
 
|transitions=TR022782;24.6,TR022783;9.1,TR022784;5.5,TR022785;5.5
 
|z1=7
 
|z1=7
 
}}
 
}}

Revision as of 20:59, 12 May 2021

Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6F]FTTAPAICHDGK.A (PE001617)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H7N6F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7,068.14
Charge 7+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
43.695 45.488 78.707 1,008.171 7+ 1,115.176 6+ Y[pH6N5F] 24.6
43.695 45.488 78.707 1,008.171 7+ 1,264.983 5+ Y[pH5N4F] 9.1
43.695 45.488 78.707 1,008.171 7+ 1,503.950 4+ Y[pH4N4] 5.5
43.695 45.488 78.707 1,008.171 7+ 1,088.167 6+ Y[pH5N5F] 5.5

Spectra

7948;EThcD;39.877;7946;1008.177;Byonic:q-value=4.89e-10/GPS:MinICScore=40.472
7950;HCD;39.887;7946;1008.177;