TG002944

From GPTWiki
Revision as of 22:18, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{TransitionGroup |gphash=1f6637a445 |mz1=1091.049 |nrt=181.703 |ntransition=9 |pepnrt=drop (+18.295) |peptide=PE001285 |prt=85.590 |rt=86.386 |scans=21899;EThcD;86.380;21896;...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide R.TEVSSNHVLIYLDKVSN[H5N4F2]QTLSLFFTVLQDVPVRDLKPAIVK.V (PE001285)
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVK
Glycans(s) H5N4F2 (N17)
Mod(s)
Molecular Weight 6,558.255
Charge 6+
Protein A2M (P01023)
Spectrum File MS_48_UO1_Erlic_E10
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
86.386 85.590 181.703 1,091.049 6+ 1,208.164 4+ Y[pN] 21.0
86.386 85.590 181.703 1,091.049 6+ 1,339.961 4+ Y[pH2N2] 16.9
86.386 85.590 181.703 1,091.049 6+ 1,177.607 5+ Y[pH4N3] 15.9
86.386 85.590 181.703 1,091.049 6+ 1,380.474 4+ Y[pH3N2] 14.9
86.386 85.590 181.703 1,091.049 6+ 1,471.757 4+ Y[pH4N3] 7.4
86.386 85.590 181.703 1,091.049 6+ 1,145.197 5+ Y[pH3N3] 7.4
86.386 85.590 181.703 1,091.049 6+ 1,299.448 4+ Y[pHN2] 6.8
86.386 85.590 181.703 1,091.049 6+ 1,610.550 3+ Y[pN] 6.4
86.386 85.590 181.703 1,091.049 6+ 1,431.244 4+ Y[pH3N3] 5.6

Spectra

21899;EThcD;86.380;21896;1091.215;Byonic:q-value=0.00464/GPS:ICScore=234.537
21901;HCD;86.386;21896;1091.215;