Difference between revisions of "TG002944"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{TransitionGroup |gphash=1f6637a445 |mz1=1091.049 |nrt=181.703 |ntransition=9 |pepnrt=drop (+18.295) |peptide=PE001285 |prt=85.590 |rt=86.386 |scans=21899;EThcD;86.380;21896;...")
 
 
Line 1: Line 1:
 
{{TransitionGroup
 
{{TransitionGroup
|gphash=1f6637a445
 
|mz1=1091.049
 
|nrt=181.703
 
|ntransition=9
 
|pepnrt=drop (+18.295)
 
 
|peptide=PE001285
 
|peptide=PE001285
|prt=85.590
 
|rt=86.386
 
|scans=21899;EThcD;86.380;21896;1091.215;Byonic:q-value=0.00464/GPS:ICScore=234.537,21901;HCD;86.386;21896;1091.215;
 
 
|spectra=MS_48_UO1_Erlic_E10
 
|spectra=MS_48_UO1_Erlic_E10
|transitions=TR018474;21.0,TR018475;16.9,TR030562;15.9,TR018476;14.9,TR030563;7.4,TR018477;7.4,TR030564;6.8,TR018478;6.4,TR018479;5.6
 
 
|z1=6
 
|z1=6
 
}}
 
}}

Latest revision as of 22:49, 12 May 2021

Peptide R.TEVSSNHVLIYLDKVSN[H5N4F2]QTLSLFFTVLQDVPVRDLKPAIVK.V (PE001285)
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVK
Glycans(s) H5N4F2 (N17)
Mod(s)
Molecular Weight 6,558.255
Charge 6+
Protein A2M (P01023)
Spectrum File MS_48_UO1_Erlic_E10
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum