Difference between revisions of "TG002878"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{TransitionGroup |gphash=ac3c079037 |mz1=1596.229 |nrt=161.205 |ntransition=5 |pepnrt=use (+2.497) |peptide=PE001258 |prt=77.393 |rt=77.332 |scans=23908;EThcD;77.326;23894;15...")
 
 
Line 8: Line 8:
 
|prt=77.393
 
|prt=77.393
 
|rt=77.332
 
|rt=77.332
|scans=23908;EThcD;77.326;23894;1596.732;Byonic:q-value=1.33e-11/GPS:ICScore=287.029,23910;HCD;77.332;23894;1596.732;
+
|scans=23908;EThcD;77.326;23894;1596.732;Byonic:q-value=1.33e-11/GPS:MinICScore=121.186,23910;HCD;77.332;23894;1596.732;
 
|spectra=MS_47_UO1_HEK_1_1n
 
|spectra=MS_47_UO1_HEK_1_1n
 
|transitions=TR030542;43.6,TR018105;15.1,TR018106;10.6,TR018107;10.2,TR018108;8.1
 
|transitions=TR030542;43.6,TR018105;15.1,TR018106;10.6,TR018107;10.2,TR018108;8.1
 
|z1=4
 
|z1=4
 
}}
 
}}

Latest revision as of 16:05, 12 May 2021

Peptide K.GTEDFIVESLDASFRYPQDYQFYIQN[H8N2]FTALPLNTVVPPQR.Q (PE001258)
Sequence GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR
Glycans(s) H8N2 (N26)
Mod(s)
Molecular Weight 6,398.894
Charge 4+
Protein SSR1 (P43307)
Spectrum File MS_47_UO1_HEK_1_1n
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample HEK293 Cells

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
77.332 77.393 161.205 1,596.229 4+ 1,628.135 3+ Y[pN] 43.6
77.332 77.393 161.205 1,596.229 4+ 1,555.715 4+ Y[pH7N2] 15.1
77.332 77.393 161.205 1,596.229 4+ 1,515.202 4+ Y[pH6N2] 10.6
77.332 77.393 161.205 1,596.229 4+ 1,474.689 4+ Y[pH5N2] 10.2
77.332 77.393 161.205 1,596.229 4+ 1,434.176 4+ Y[pH4N2] 8.1

Spectra

23908;EThcD;77.326;23894;1596.732;Byonic:q-value=1.33e-11/GPS:MinICScore=121.186
23910;HCD;77.332;23894;1596.732;