TG002876

From GPTWiki
Revision as of 22:49, 12 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.GHDLNEDGLVSWEEYKN[H3N3F]ATYGYVLDDPDPDDGFNYK.Q (PE001257)
Sequence GHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYK
Glycans(s) H3N3F (N17)
Mod(s)
Molecular Weight 5,409.268
Charge 4+
Protein CALU (O43852)
Spectrum File MS_47_UO1_erlic_HEK12
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample HEK293 Cells