TG002856

From GPTWiki
Revision as of 16:03, 23 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.YTGN[H7N6S4]ASALFILPDQDKMEEVEAMLLPETLKR.W (PE001248)
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H7N6S4 (N4)
Mod(s)
Molecular Weight 7,057.017
Charge 5+
Protein SERPINA3 (P01011)
Spectrum File MS_35_Frac_plasma_run01_fr9_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
86.124 85.967 187.396 1,408.809 5+ 1,715.795 3+ Y[pH5N4] 23.1
86.124 85.967 187.396 1,408.809 5+ 1,523.929 4+ Y[pH6N5S2] 18.8
86.124 85.967 187.396 1,408.809 5+ 1,540.066 3+ Y[pH3N3] 18.5
86.124 85.967 187.396 1,408.809 5+ 1,812.826 3+ Y[pH5N4S] 15.6
86.124 85.967 187.396 1,408.809 5+ 1,596.702 4+ Y[pH6N5S3] 11.8
86.124 85.967 187.396 1,408.809 5+ 1,451.155 4+ Y[pH6N5S] 9.1
86.124 85.967 187.396 1,408.809 5+ 1,661.777 3+ Y[pH4N4] 8.7
86.124 85.967 187.396 1,408.809 5+ 1,242.627 3+ Y[pN] 8.7
86.124 85.967 187.396 1,408.809 5+ 1,637.098 3+ Y[pH3N3S] 8.6
86.124 85.967 187.396 1,408.809 5+ 1,594.084 3+ Y[pH4N3] 6.7
86.124 85.967 187.396 1,408.809 5+ 1,909.858 3+ Y[pH5N4S2] 6.4

Spectra

22103;EThcD;86.116;22102;1409.004;Byonic:q-value=0.000899/GPS:MinICScore=34.656
22105;HCD;86.124;22102;1409.004;