TG002798

From GPTWiki
Revision as of 14:55, 14 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide R.QLAHQSN[H5N4S2]STNIFFSPVSIATAFAM[Ox]LSLGTK.A (PE001184)
Sequence QLAHQSNSTNIFFSPVSIATAFAMLSLGTK
Glycans(s) H5N4S2 (N7)
Mod(s) 15.995 (M24)
Molecular Weight 5,419.406
Charge 4+
Protein SERPINA1 (P01009)
Spectrum File MS_35_Frac_plasma_run01_fr13_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
86.078 86.292 178.994 1,351.357 4+ 1,278.583 4+ Y[pH5N4S] 29.7
86.078 86.292 178.994 1,351.357 4+ 1,700.859 2+ Y[pN] 15.4
86.078 86.292 178.994 1,351.357 4+ 1,582.730 3+ Y[pH4N3S] 14.5
86.078 86.292 178.994 1,351.357 4+ 1,485.699 3+ Y[pH4N3] 12.8
86.078 86.292 178.994 1,351.357 4+ 1,964.451 2+ Y[pH2N2] 9.3
86.078 86.292 178.994 1,351.357 4+ 1,431.681 3+ Y[pH3N3] 9.1
86.078 86.292 178.994 1,351.357 4+ 1,528.713 3+ Y[pH3N3S] 5.7
86.078 86.292 178.994 1,351.357 4+ 1,205.809 4+ Y[pH5N4] 5.1

Spectra

17849;EThcD;86.074;17845;1351.602;Byonic:q-value=1.27e-07/GPS:MinICScore=45.096
17850;HCD;86.078;17845;1351.602;