Difference between revisions of "TG002798"

Latest revision as of 15:55, 14 May 2021

Peptide	R.QLAHQSN[H5N4S2]STNIFFSPVSIATAFAM[Ox]LSLGTK.A (PE001184)
Sequence	QLAHQSNSTNIFFSPVSIATAFAMLSLGTK
Glycans(s)	H5N4S2 (N7)
Mod(s)	15.995 (M24)
Molecular Weight	5,419.406
Charge	4+
Protein	SERPINA1 (P01009)
Spectrum File	MS_35_Frac_plasma_run01_fr13_01
Method	Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction	SAX-ERLICH Enrichment
Sample	Human Serum

Exp. R.T.	Peak R.T.	Norm. R.T.	Prec. m/z	Prec. z	Prod. m/z	Prod. z	Label	%Int
86.078	86.292	178.994	1,351.357	4+	1,278.583	4+	Y[pH5N4S]	29.7
86.078	86.292	178.994	1,351.357	4+	1,700.859	2+	Y[pN]	15.4
86.078	86.292	178.994	1,351.357	4+	1,582.730	3+	Y[pH4N3S]	14.5
86.078	86.292	178.994	1,351.357	4+	1,485.699	3+	Y[pH4N3]	12.8
86.078	86.292	178.994	1,351.357	4+	1,964.451	2+	Y[pH2N2]	9.3
86.078	86.292	178.994	1,351.357	4+	1,431.681	3+	Y[pH3N3]	9.1
86.078	86.292	178.994	1,351.357	4+	1,528.713	3+	Y[pH3N3S]	5.7
86.078	86.292	178.994	1,351.357	4+	1,205.809	4+	Y[pH5N4]	5.1

17849;EThcD;86.074;17845;1351.602;Byonic:q-value=1.27e-07/GPS:MinICScore=45.096
17850;HCD;86.078;17845;1351.602;

@@ Line 4: / Line 4: @@
 |nrt=178.994
 |ntransition=8
-|pepnrt=drop (+7.612)
+|pepnrt=drop (+7.895)
 |peptide=PE001184
 |prt=86.292