Difference between revisions of "TG002794"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{TransitionGroup |gphash=0867e9ed0b |mz1=1347.358 |ntransition=7 |peptide=PE001185 |rt=90.013 |scans=23150;EThcD;90.007;23144;1347.356;Byonic:q-value=7.16e-08/GPS:ICScore=11....")
 
 
Line 5: Line 5:
 
|peptide=PE001185
 
|peptide=PE001185
 
|rt=90.013
 
|rt=90.013
|scans=23150;EThcD;90.007;23144;1347.356;Byonic:q-value=7.16e-08/GPS:ICScore=11.305,23152;HCD;90.013;23144;1347.356;
+
|scans=23150;EThcD;90.007;23144;1347.356;Byonic:q-value=7.16e-08/GPS:MinICScore=11.305,23152;HCD;90.013;23144;1347.356;
 
|spectra=MS_35_Frac_plasma_run01_fr12_01
 
|spectra=MS_35_Frac_plasma_run01_fr12_01
 
|transitions=TR017340;18.8,TR017341;17.3,TR017342;14.6,TR017343;12.7,TR017344;9.2,TR017345;6.8,TR017346;5.4
 
|transitions=TR017340;18.8,TR017341;17.3,TR017342;14.6,TR017343;12.7,TR017344;9.2,TR017345;6.8,TR017346;5.4
 
|z1=4
 
|z1=4
 
}}
 
}}

Latest revision as of 13:05, 12 May 2021

Peptide R.QLAHQSN[H5N4S2]STNIFFSPVSIATAFAMLSLGTK.A (PE001185)
Sequence QLAHQSNSTNIFFSPVSIATAFAMLSLGTK
Glycans(s) H5N4S2 (N7)
Mod(s)
Molecular Weight 5,403.411
Charge 4+
Protein SERPINA1 (P01009)
Spectrum File MS_35_Frac_plasma_run01_fr12_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
90.013 1,347.358 4+ 1,274.584 4+ Y[pH5N4S] 18.8
90.013 1,347.358 4+ 1,692.861 2+ Y[pN] 17.3
90.013 1,347.358 4+ 1,577.399 3+ Y[pH4N3S] 14.6
90.013 1,347.358 4+ 1,480.367 3+ Y[pH4N3] 12.7
90.013 1,347.358 4+ 1,956.454 2+ Y[pH2N2] 9.2
90.013 1,347.358 4+ 1,426.349 3+ Y[pH3N3] 6.8
90.013 1,347.358 4+ 1,523.381 3+ Y[pH3N3S] 5.4

Spectra

23150;EThcD;90.007;23144;1347.356;Byonic:q-value=7.16e-08/GPS:MinICScore=11.305
23152;HCD;90.013;23144;1347.356;