TG002724

From GPTWiki
Revision as of 21:51, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{TransitionGroup |gphash=71d8aceb66 |mz1=1310.385 |nrt=159.754 |ntransition=17 |pepnrt=use (-0.985) |peptide=PE000073 |prt=75.063 |rt=75.053 |scans=18995;EThcD;75.046;18981;1...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.YLGN[H6N5FS3]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000073)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H6N5FS3 (N4)
Mod(s)
Molecular Weight 6,564.899
Charge 5+
Protein SERPINA1 (P01009)
Spectrum File MS_35_Frac_plasma_run01_fr9_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
75.053 75.063 159.754 1,310.385 5+ 1,600.101 3+ Y[pH4N3] 20.4
75.053 75.063 159.754 1,310.385 5+ 1,424.373 3+ Y[pH2N2] 20.3
75.053 75.063 159.754 1,310.385 5+ 1,546.083 3+ Y[pH3N3] 15.2
75.053 75.063 159.754 1,310.385 5+ 1,248.644 3+ Y[pN] 13.4
75.053 75.063 159.754 1,310.385 5+ 1,872.463 2+ Y[pN] 8.7
75.053 75.063 159.754 1,310.385 5+ 1,370.355 3+ Y[pHN2] 8.5
75.053 75.063 159.754 1,310.385 5+ 1,364.385 4+ Y[pH5N4S] 7.4
75.053 75.063 159.754 1,310.385 5+ 1,721.812 3+ Y[pH5N4] 6.4
75.053 75.063 159.754 1,310.385 5+ 1,437.158 4+ Y[pH5N4S2] 6.0
75.053 75.063 159.754 1,310.385 5+ 1,473.673 4+ Y[pH5N4FS2] 5.9
75.053 75.063 159.754 1,310.385 5+ 1,473.059 3+ Y[pH2N2F]* 5.9
75.053 75.063 159.754 1,310.385 5+ 1,365.023 3+ Y[pN2F]* 5.7
75.053 75.063 159.754 1,310.385 5+ 1,697.133 3+ Y[pH4N3S] 5.7
75.053 75.063 159.754 1,310.385 5+ 1,400.899 4+ Y[pH5N4FS] 5.7
75.053 75.063 159.754 1,310.385 5+ 1,492.066 3+ Y[pH2N3] 5.4
75.053 75.063 159.754 1,310.385 5+ 1,316.337 3+ Y[pN2] 5.4
75.053 75.063 159.754 1,310.385 5+ 1,667.794 3+ Y[pH4N4] 5.1

Spectra

18995;EThcD;75.046;18981;1310.582;Byonic:q-value=1.57e-05/GPS:ICScore=42.500
18997;HCD;75.053;18981;1310.582;