TG002675

From GPTWiki
Revision as of 15:57, 23 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide R.FSLLGHASISCTVEN[H5N4S2]ETIGVWRPSPPTCEK.I (PE000134)
Sequence FSLLGHASISCTVENETIGVWRPSPPTCEK
Glycans(s) H5N4S2 (N15)
Mod(s) 57.021 (C11), 57.021 (C28)
Molecular Weight 5,594.411
Charge 5+
Protein C4BPA (P04003)
Spectrum File MS_35_Frac_plasma_run01_fr9_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
49.703 49.875 95.904 1,116.293 5+ 1,192.585 3+ Y[pN] 29.2
49.703 49.875 95.904 1,116.293 5+ 1,422.331 3+ Y[pH3N2] 17.8
49.703 49.875 95.904 1,116.293 5+ 1,368.314 3+ Y[pH2N2] 16.9
49.703 49.875 95.904 1,116.293 5+ 1,117.770 4+ Y[pH3N3] 16.4
49.703 49.875 95.904 1,116.293 5+ 1,544.042 3+ Y[pH4N3] 15.2
49.703 49.875 95.904 1,116.293 5+ 1,490.024 3+ Y[pH3N3] 10.8
49.703 49.875 95.904 1,116.293 5+ 1,314.296 3+ Y[pHN2] 6.2

Spectra

11552;EThcD;49.697;11548;1116.486;Byonic:q-value=2.23e-12/GPS:MinICScore=21.788
11554;HCD;49.703;11548;1116.486;