TG001296

From GPTWiki
Revision as of 16:42, 23 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H6N5S3]YSCSYR.T (PE000628)
Sequence REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H6N5S3 (N28)
Mod(s) 57.021 (C31)
Molecular Weight 6,870.781
Charge 5+
Protein A1BG (P04217)
Spectrum File MS_35_Frac_plasma_run02_fr7
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
45.905 45.716 83.514 1,371.565 5+ 1,477.373 4+ Y[pH5N4S] 32.1
45.905 45.716 83.514 1,371.565 5+ 1,750.752 3+ Y[pH4N3] 29.4
45.905 45.716 83.514 1,371.565 5+ 1,575.024 3+ Y[pH2N2] 28.5
45.905 45.716 83.514 1,371.565 5+ 1,550.147 4+ Y[pH5N4S2] 19.6
45.905 45.716 83.514 1,371.565 5+ 1,399.295 3+ Y[pN] 19.4
45.905 45.716 83.514 1,371.565 5+ 1,404.599 4+ Y[pH5N4] 15.0
45.905 45.716 83.514 1,371.565 5+ 1,521.006 3+ Y[pHN2] 13.0
45.905 45.716 83.514 1,371.565 5+ 1,049.724 4+ Y[pN] 12.8
45.905 45.716 83.514 1,371.565 5+ 1,345.577 4+ Y[pH3N3S] 9.5
45.905 45.716 83.514 1,371.565 5+ 1,872.463 3+ Y[pH5N4] 7.3
45.905 45.716 83.514 1,371.565 5+ 1,272.803 4+ Y[pH3N3] 6.5
45.905 45.716 83.514 1,371.565 5+ 1,818.445 3+ Y[pH4N4] 6.4
45.905 45.716 83.514 1,371.565 5+ 1,436.860 4+ Y[pH4N4S] 5.3

Spectra

11053;EThcD;45.899;11051;1371.958;Byonic:q-value=8.53e-09/GPS:MinICScore=62.726
11055;HCD;45.905;11051;1371.958;