TG001160

From GPTWiki
Revision as of 16:06, 12 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.YLGN[H5N4]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000346)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4 (N4)
Mod(s)
Molecular Weight 5,180.422
Charge 5+
Protein SERPINA1 (P01009)
Spectrum File MS_35_Frac_plasma_run02_fr17
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
60.570 1,033.490 5+ 1,248.644 3+ Y[pN] 52.1
60.570 1,033.490 5+ 1,872.463 2+ Y[pN] 37.2
60.570 1,033.490 5+ 1,424.373 3+ Y[pH2N2] 26.1
60.570 1,033.490 5+ 1,478.390 3+ Y[pH3N2] 22.6
60.570 1,033.490 5+ 1,370.355 3+ Y[pHN2] 16.8
60.570 1,033.490 5+ 1,316.337 3+ Y[pN2] 15.3
60.570 1,033.490 5+ 1,180.951 3+ Y[p] 8.6
60.570 1,033.490 5+ 1,770.923 2+ Y[p] 8.3

Spectra

14828;EThcD;60.562;14827;1033.687;Byonic:q-value=0.000219/GPS:MinICScore=4.436
14830;HCD;60.570;14827;1033.687;