TG000761

From GPTWiki
Revision as of 15:25, 14 May 2021 by Edwardsnj (talk | contribs)
Jump to navigation Jump to search
Peptide K.YLGN[H5N4S]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000220)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4S (N4)
Mod(s)
Molecular Weight 5,471.518
Charge 4+
Protein SERPINA1 (P01009)
Spectrum File MS_35_Frac_plasma_run02_fr11
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
65.305 65.610 135.374 1,364.385 4+ 1,600.101 3+ Y[pH4N3] 50.0
65.305 65.610 135.374 1,364.385 4+ 1,546.083 3+ Y[pH3N3] 25.1
65.305 65.610 135.374 1,364.385 4+ 1,424.373 3+ Y[pH2N2] 9.5
65.305 65.610 135.374 1,364.385 4+ 1,291.611 4+ Y[pH5N4] 8.5
65.305 65.610 135.374 1,364.385 4+ 1,248.644 3+ Y[pN] 8.3
65.305 65.610 135.374 1,364.385 4+ 1,697.133 3+ Y[pH4N3S] 7.4
65.305 65.610 135.374 1,364.385 4+ 1,478.390 3+ Y[pH3N2] 7.3
65.305 65.610 135.374 1,364.385 4+ 1,316.337 3+ Y[pN2] 5.2

Spectra

16203;EThcD;65.252;16194;1364.388;Byonic:q-value=1.01e-09/GPS:MinICScore=6.529
16205;HCD;65.259;16194;1364.388;
16230;EThcD;65.346;16225;1364.372;Byonic:q-value=5.77e-10/GPS:MinICScore=7.555
16232;HCD;65.352;16225;1364.372;