Difference between revisions of "TG000761"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{TransitionGroup |gphash=074fa328c9 |mz1=1364.385 |nrt=135.374 |ntransition=8 |pepnrt=use (+1.593) |peptide=PE000220 |prt=65.610 |rt=65.305 |scans=16203;EThcD;65.252;16194;13...")
 
 
(2 intermediate revisions by the same user not shown)
Line 4: Line 4:
 
|nrt=135.374
 
|nrt=135.374
 
|ntransition=8
 
|ntransition=8
|pepnrt=use (+1.593)
+
|pepnrt=use (+1.923)
 
|peptide=PE000220
 
|peptide=PE000220
 
|prt=65.610
 
|prt=65.610
 
|rt=65.305
 
|rt=65.305
|scans=16203;EThcD;65.252;16194;1364.388;Byonic:q-value=1.01e-09/GPS:ICScore=7.268,16205;HCD;65.259;16194;1364.388;,16230;EThcD;65.346;16225;1364.372;Byonic:q-value=5.77e-10/GPS:ICScore=16.092,16232;HCD;65.352;16225;1364.372;
+
|scans=16203;EThcD;65.252;16194;1364.388;Byonic:q-value=1.01e-09/GPS:MinICScore=6.529,16205;HCD;65.259;16194;1364.388;,16230;EThcD;65.346;16225;1364.372;Byonic:q-value=5.77e-10/GPS:MinICScore=7.555,16232;HCD;65.352;16225;1364.372;
 
|spectra=MS_35_Frac_plasma_run02_fr11
 
|spectra=MS_35_Frac_plasma_run02_fr11
 
|transitions=TR005877;50.0,TR005878;25.1,TR030010;9.5,TR005879;8.5,TR005880;8.3,TR030011;7.4,TR005881;7.3,TR005882;5.2
 
|transitions=TR005877;50.0,TR005878;25.1,TR030010;9.5,TR005879;8.5,TR005880;8.3,TR030011;7.4,TR005881;7.3,TR005882;5.2
 
|z1=4
 
|z1=4
 
}}
 
}}

Latest revision as of 15:13, 23 May 2021

Peptide K.YLGN[H5N4S]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000220)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4S (N4)
Mod(s)
Molecular Weight 5,471.518
Charge 4+
Protein SERPINA1 (P01009)
Spectrum File MS_35_Frac_plasma_run02_fr11
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
65.305 65.610 135.374 1,364.385 4+ 1,600.101 3+ Y[pH4N3] 50.0
65.305 65.610 135.374 1,364.385 4+ 1,546.083 3+ Y[pH3N3] 25.1
65.305 65.610 135.374 1,364.385 4+ 1,424.373 3+ Y[pH2N2] 9.5
65.305 65.610 135.374 1,364.385 4+ 1,291.611 4+ Y[pH5N4] 8.5
65.305 65.610 135.374 1,364.385 4+ 1,248.644 3+ Y[pN] 8.3
65.305 65.610 135.374 1,364.385 4+ 1,697.133 3+ Y[pH4N3S] 7.4
65.305 65.610 135.374 1,364.385 4+ 1,478.390 3+ Y[pH3N2] 7.3
65.305 65.610 135.374 1,364.385 4+ 1,316.337 3+ Y[pN2] 5.2

Spectra

16203;EThcD;65.252;16194;1364.388;Byonic:q-value=1.01e-09/GPS:MinICScore=6.529
16205;HCD;65.259;16194;1364.388;
16230;EThcD;65.346;16225;1364.372;Byonic:q-value=5.77e-10/GPS:MinICScore=7.555
16232;HCD;65.352;16225;1364.372;