TG000658

From GPTWiki
Revision as of 16:19, 14 May 2021 by Edwardsnj (talk | contribs)
Jump to navigation Jump to search
Peptide K.YTGN[H6N5S3]ASALFILPDQDKMEEVEAMLLPETLKR.W (PE000081)
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H6N5S3 (N4)
Mod(s)
Molecular Weight 6,400.789
Charge 5+
Protein SERPINA3 (P01011)
Spectrum File MS_35_Frac_plasma_run02_fr10
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
78.514 78.472 167.821 1,277.564 5+ 1,594.084 3+ Y[pH4N3] 20.6
78.514 78.472 167.821 1,277.564 5+ 1,418.355 3+ Y[pH2N2] 17.6
78.514 78.472 167.821 1,277.564 5+ 1,540.066 3+ Y[pH3N3] 15.5
78.514 78.472 167.821 1,277.564 5+ 1,242.627 3+ Y[pN] 13.8
78.514 78.472 167.821 1,277.564 5+ 1,364.338 3+ Y[pHN2] 8.7
78.514 78.472 167.821 1,277.564 5+ 1,359.872 4+ Y[pH5N4S] 7.9
78.514 78.472 167.821 1,277.564 5+ 1,691.116 3+ Y[pH4N3S] 7.6
78.514 78.472 167.821 1,277.564 5+ 1,863.437 2+ Y[pN] 5.8
78.514 78.472 167.821 1,277.564 5+ 1,432.646 4+ Y[pH5N4S2] 5.3
78.514 78.472 167.821 1,277.564 5+ 1,715.795 3+ Y[pH5N4] 5.3
78.514 78.472 167.821 1,277.564 5+ 1,310.320 3+ Y[pN2] 5.2

Spectra

19531;EThcD;78.499;19525;1277.559;Byonic:q-value=0.000157/GPS:MinICScore=40.978
19533;HCD;78.504;19525;1277.559;