Difference between revisions of "TG000658"
Jump to navigation
Jump to search
(Created page with "{{TransitionGroup |gphash=5886f96ff0 |mz1=1277.564 |nrt=167.821 |ntransition=11 |pepnrt=use (-0.139) |peptide=PE000081 |prt=78.472 |rt=78.514 |scans=19531;EThcD;78.499;19525;1...") |
|||
(2 intermediate revisions by the same user not shown) | |||
Line 4: | Line 4: | ||
|nrt=167.821 | |nrt=167.821 | ||
|ntransition=11 | |ntransition=11 | ||
− | |pepnrt=use ( | + | |pepnrt=use (+0.116) |
|peptide=PE000081 | |peptide=PE000081 | ||
|prt=78.472 | |prt=78.472 | ||
|rt=78.514 | |rt=78.514 | ||
− | |scans=19531;EThcD;78.499;19525;1277.559;Byonic:q-value=0.000157/GPS: | + | |scans=19531;EThcD;78.499;19525;1277.559;Byonic:q-value=0.000157/GPS:MinICScore=40.978,19533;HCD;78.504;19525;1277.559; |
|spectra=MS_35_Frac_plasma_run02_fr10 | |spectra=MS_35_Frac_plasma_run02_fr10 | ||
|transitions=TR005174;20.6,TR005175;17.6,TR005176;15.5,TR005177;13.8,TR005178;8.7,TR005180;7.9,TR005179;7.6,TR005181;5.8,TR005183;5.3,TR005182;5.3,TR005184;5.2 | |transitions=TR005174;20.6,TR005175;17.6,TR005176;15.5,TR005177;13.8,TR005178;8.7,TR005180;7.9,TR005179;7.6,TR005181;5.8,TR005183;5.3,TR005182;5.3,TR005184;5.2 | ||
|z1=5 | |z1=5 | ||
}} | }} |
Latest revision as of 16:07, 23 May 2021
Peptide | K.YTGN[H6N5S3]ASALFILPDQDKMEEVEAMLLPETLKR.W (PE000081) |
---|---|
Sequence | YTGNASALFILPDQDKMEEVEAMLLPETLKR |
Glycans(s) | H6N5S3 (N4) |
Mod(s) | |
Molecular Weight | 6,400.789 |
Charge | 5+ |
Protein | SERPINA3 (P01011) |
Spectrum File | MS_35_Frac_plasma_run02_fr10 |
Method | Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS |
Analytical Fraction | SAX-ERLICH Enrichment |
Sample | Human Serum |
Transitions
Exp. R.T. | Peak R.T. | Norm. R.T. | Prec. m/z | Prec. z | Prod. m/z | Prod. z | Label | %Int |
---|---|---|---|---|---|---|---|---|
78.514 | 78.472 | 167.821 | 1,277.564 | 5+ | 1,594.084 | 3+ | Y[pH4N3] | 20.6 |
78.514 | 78.472 | 167.821 | 1,277.564 | 5+ | 1,418.355 | 3+ | Y[pH2N2] | 17.6 |
78.514 | 78.472 | 167.821 | 1,277.564 | 5+ | 1,540.066 | 3+ | Y[pH3N3] | 15.5 |
78.514 | 78.472 | 167.821 | 1,277.564 | 5+ | 1,242.627 | 3+ | Y[pN] | 13.8 |
78.514 | 78.472 | 167.821 | 1,277.564 | 5+ | 1,364.338 | 3+ | Y[pHN2] | 8.7 |
78.514 | 78.472 | 167.821 | 1,277.564 | 5+ | 1,359.872 | 4+ | Y[pH5N4S] | 7.9 |
78.514 | 78.472 | 167.821 | 1,277.564 | 5+ | 1,691.116 | 3+ | Y[pH4N3S] | 7.6 |
78.514 | 78.472 | 167.821 | 1,277.564 | 5+ | 1,863.437 | 2+ | Y[pN] | 5.8 |
78.514 | 78.472 | 167.821 | 1,277.564 | 5+ | 1,432.646 | 4+ | Y[pH5N4S2] | 5.3 |
78.514 | 78.472 | 167.821 | 1,277.564 | 5+ | 1,715.795 | 3+ | Y[pH5N4] | 5.3 |
78.514 | 78.472 | 167.821 | 1,277.564 | 5+ | 1,310.320 | 3+ | Y[pN2] | 5.2 |
Spectra
19531;EThcD;78.499;19525;1277.559;Byonic:q-value=0.000157/GPS:MinICScore=40.978
19533;HCD;78.504;19525;1277.559;