TG000650

From GPTWiki
Revision as of 19:28, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{TransitionGroup |gphash=5886f96ff0 |mz1=1596.702 |nrt=167.839 |ntransition=10 |pepnrt=use (-0.121) |peptide=PE000081 |prt=78.479 |rt=78.514 |scans=19536;EThcD;78.516;19525;1...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.YTGN[H6N5S3]ASALFILPDQDKMEEVEAMLLPETLKR.W (PE000081)
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H6N5S3 (N4)
Mod(s)
Molecular Weight 6,400.789
Charge 4+
Protein SERPINA3 (P01011)
Spectrum File MS_35_Frac_plasma_run02_fr10
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
78.514 78.479 167.839 1,596.702 4+ 1,523.929 4+ Y[pH6N5S2] 63.3
78.514 78.479 167.839 1,596.702 4+ 1,715.795 3+ Y[pH5N4] 27.0
78.514 78.479 167.839 1,596.702 4+ 1,540.066 3+ Y[pH3N3] 21.6
78.514 78.479 167.839 1,596.702 4+ 1,812.826 3+ Y[pH5N4S] 17.3
78.514 78.479 167.839 1,596.702 4+ 1,242.627 3+ Y[pN] 13.7
78.514 78.479 167.839 1,596.702 4+ 1,909.858 3+ Y[pH5N4S2] 11.2
78.514 78.479 167.839 1,596.702 4+ 1,637.098 3+ Y[pH3N3S] 9.3
78.514 78.479 167.839 1,596.702 4+ 1,661.777 3+ Y[pH4N4] 6.3
78.514 78.479 167.839 1,596.702 4+ 1,594.084 3+ Y[pH4N3] 6.1
78.514 78.479 167.839 1,596.702 4+ 1,310.320 3+ Y[pN2] 5.1

Spectra

19536;EThcD;78.516;19525;1596.697;Byonic:q-value=0.000157/GPS:ICScore=21.320
19538;HCD;78.523;19525;1596.697;