TG000189

From GPTWiki
Revision as of 14:31, 20 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.HLQMDIHIFEPQGISFLETESTFMTNQLVDALTTWQN[H5N4]K.T (PE000358)
Sequence HLQMDIHIFEPQGISFLETESTFMTNQLVDALTTWQNK
Glycans(s) H5N4 (N37)
Mod(s)
Molecular Weight 6,102.754
Charge 4+
Protein ITIH4 (Q14624)
Spectrum File MS_31_UO1_MS2_new_measurement_02
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
80.719 79.687 1,522.194 4+ 1,556.088 3+ Y[pN] 40.5
80.719 79.687 1,522.194 4+ 1,218.088 4+ Y[pN2] 32.0
80.719 79.687 1,522.194 4+ 1,488.395 3+ Y[p] 6.6
80.719 79.687 1,522.194 4+ 1,731.816 3+ Y[pH2N2] 6.3

Spectra

20723;EThcD;80.178;20722;1493.851;Byonic:q-value=3.17e-07/GPS:MinICScore=372.732
20725;HCD;80.186;20722;1493.851;
20869;EThcD;80.713;20867;1218.148;Byonic:q-value=3.87e-07/GPS:MinICScore=1448.170
20871;HCD;80.719;20867;1218.148;
20888;EThcD;80.783;20881;1215.030;Byonic:q-value=3.98e-07/GPS:MinICScore=100000000000000000000.000
20890;HCD;80.791;20881;1215.030;