TG000159

From GPTWiki
Revision as of 16:22, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{TransitionGroup |mz1=1378.381 |nrt=127.094 |ntransition=8 |peptide=PE000298 |prt=58.285 |rt=58.424 |spectra=MS_31_UO1_MS2_new_measurement_02 |z1=4 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.YTGN[H6N5]ASALFILPDQDKMEEVEAMLLPETLKR.W (PE000298)
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H6N5 (N4)
Mod(s)
Molecular Weight 5,527.503
Charge 4+
Protein SERPINA3 (P01011)
Spectrum File MS_31_UO1_MS2_new_measurement_02
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human Serum