Difference between revisions of "TG000159"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{TransitionGroup |mz1=1378.381 |nrt=127.094 |ntransition=8 |peptide=PE000298 |prt=58.285 |rt=58.424 |spectra=MS_31_UO1_MS2_new_measurement_02 |z1=4 }}")
 
 
Line 1: Line 1:
 
{{TransitionGroup
 
{{TransitionGroup
|mz1=1378.381
 
|nrt=127.094
 
|ntransition=8
 
 
|peptide=PE000298
 
|peptide=PE000298
|prt=58.285
 
|rt=58.424
 
 
|spectra=MS_31_UO1_MS2_new_measurement_02
 
|spectra=MS_31_UO1_MS2_new_measurement_02
 
|z1=4
 
|z1=4
 
}}
 
}}

Latest revision as of 23:52, 12 May 2021

Peptide K.YTGN[H6N5]ASALFILPDQDKMEEVEAMLLPETLKR.W (PE000298)
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H6N5 (N4)
Mod(s)
Molecular Weight 5,527.503
Charge 4+
Protein SERPINA3 (P01011)
Spectrum File MS_31_UO1_MS2_new_measurement_02
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human Serum