All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 18:04, 6 April 2021 Edwardsnj talk contribs created page Q96PD5 (Created page with "{{Protein |accession=Q96PD5 |description=N-acetylmuramoyl-L-alanine amidase |gene=PGLYRP2 |name=PGLYRP2 |sequence=MAQGVLWILLGLLLWSDPGTASLPLLMDSVIQALAELEQKVPAAKTRHTASAWLMSAPNS...")