All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 11:26, 8 May 2021 Edwardsnj talk contribs created page Q92626 (Created page with "{{Protein |accession=Q92626 |description=Peroxidasin homolog |gene=PXDN |name=PXDN |sequence=MAKRSRGPGRRCLLALVLFCAWGTLAVVAQKPGAGCPSRCLCFRTTVRCMHLLLEAVPAV APQTSILDLRFNRIREIQPGA...")