All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 07:34, 7 April 2021 Edwardsnj talk contribs created page Q92542 (Created page with "{{Protein |accession=Q92542 |description=Nicastrin |gene=NCSTN |name=NCSTN |sequence=MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQI GCQSSISGDTGVIHVVEKEEDLQWVLTDG...")