All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 07:26, 7 April 2021 Edwardsnj talk contribs created page Q8N766 (Created page with "{{Protein |accession=Q8N766 |description=ER membrane protein complex subunit 1 |gene=EMC1 |name=EMC1 |sequence=MAAEWASRFWLWATLLIPAAAVYEDQVGKFDWRQQYVGKVKFASLEFSPGSKKLVVATEK NVI...")