All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 05:44, 7 April 2021 Edwardsnj talk contribs created page Q14108 (Created page with "{{Protein |accession=Q14108 |description=Lysosome membrane protein 2 |gene=SCARB2 |name=SCARB2 |sequence=MGRCCFYTAGTLSLLLLVTSVTLLVARVFQKAVDQSIEKKIVLRNGTEAFDSWEKPPLPV YTQFYFFNV...")