All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 03:59, 7 April 2021 Edwardsnj talk contribs created page PE002177 (Created page with "{{Peptide |glycan=G83555HU;N7 |mw=4967.278 |name=R.QLAHQSN{{!(}}H5N4F{{!)}}STNIFFSPVSIATAFAMLSLGTK.A |nox=0 |nrt=158.545 |nrtobs=1 |sequence=QLAHQSNSTNIFFSPVSIATAFAMLSLGTK }}{...")