All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 17:32, 6 April 2021 Edwardsnj talk contribs created page PE001656 (Created page with "{{Peptide |glycan=G73686WG;N29 |mod=+57.021;C37 |mw=7359.236 |name=K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN{{!(}}H7N6FS{{!)}}FTTAPAICHDGK.A |nox=0 |nrt=69.303 |nrtobs=1 |sequence=GYHLM...")