All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 14:47, 6 April 2021 Edwardsnj talk contribs created page PE001554 (Created page with "{{Peptide |glycan=G85144OK;N29 |mod=+57.021;C37 |mw=7285.199 |name=K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN{{!(}}H6N5FS2{{!)}}FTTAPAICHDGK.A |nox=0 |sequence=GYHLMSFPQSAPHGVVFLHVTYVPAQ...")