All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 18:09, 6 April 2021 Edwardsnj talk contribs created page PE001546 (Created page with "{{Peptide |glycan=G41044JW;N29 |mod=+57.021;C37 |mw=7941.426 |name=K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN{{!(}}H7N6FS3{{!)}}FTTAPAICHDGK.A |nox=0 |sequence=GYHLMSFPQSAPHGVVFLHVTYVPAQ...")