All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 03:44, 7 April 2021 Edwardsnj talk contribs created page PE001285 (Created page with "{{Peptide |glycan=G60923RB;N17 |mw=6558.255 |name=R.TEVSSNHVLIYLDKVSN{{!(}}H5N4F2{{!)}}QTLSLFFTVLQDVPVRDLKPAIVK.V |nox=0 |sequence=TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVK }}...")