All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 08:10, 7 April 2021 Edwardsnj talk contribs created page PE001247 (Created page with "{{Peptide |glycan=G00912UN;N4 |mw=5744.562 |name=K.YTGN{{!(}}H5N4S2{{!)}}ASALFILPDQDKMEEVEAMLLPETLKR.W |nox=0 |sequence=YTGNASALFILPDQDKMEEVEAMLLPETLKR }}{{Alignment |end=298...")