All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 02:04, 7 April 2021 Edwardsnj talk contribs created page PE001185 (Created page with "{{Peptide |glycan=G00912UN;N7 |mw=5403.411 |name=R.QLAHQSN{{!(}}H5N4S2{{!)}}STNIFFSPVSIATAFAMLSLGTK.A |nox=0 |sequence=QLAHQSNSTNIFFSPVSIATAFAMLSLGTK }}{{Alignment |end=93 |la...")