All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 06:36, 7 April 2021 Edwardsnj talk contribs created page PE000077 (Created page with "{{Peptide |glycan=G00912UN;N4 |mw=5588.460 |name=K.YTGN{{!(}}H5N4S2{{!)}}ASALFILPDQDKMEEVEAMLLPETLK.R |nox=0 |nrt=172.906 |nrtobs=2 |sequence=YTGNASALFILPDQDKMEEVEAMLLPETLK }}...")