All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 14:50, 6 April 2021 Edwardsnj talk contribs created page P36955 (Created page with "{{Protein |accession=P36955 |description=Pigment epithelium-derived factor |gene=SERPINF1 |name=SERPINF1 |sequence=MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSN...")