All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 01:45, 7 April 2021 Edwardsnj talk contribs created page P19652 (Created page with "{{Protein |accession=P19652 |description=Alpha-1-acid glycoprotein 2 |gene=ORM2 |name=ORM2 |sequence=MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQ EIQATFFYFTPNK...")