All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 05:35, 7 April 2021 Edwardsnj talk contribs created page P08603 (Created page with "{{Protein |accession=P08603 |description=Complement factor H |gene=CFH |name=CFH |sequence=MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLG NVIMVCRKGEWVALNPLRKCQKR...")