All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 07:09, 7 April 2021 Edwardsnj talk contribs created page P06756 (Created page with "{{Protein |accession=P06756 |description=Integrin alpha-V |gene=ITGAV |name=ITGAV |sequence=MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA SSRMFLLVGAPKANTTQPGIVE...")