All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 04:37, 7 April 2021 Edwardsnj talk contribs created page P06681 (Created page with "{{Protein |accession=P06681 |description=Complement C2 |gene=C2 |name=C2 |sequence=MGPLMVLFCLLFLYPGLADSAPSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPA SRLCKSSGQWQTPGATRSLSKAVCKPVRCPA...")