All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 06:41, 7 April 2021 Edwardsnj talk contribs created page P05090 (Created page with "{{Protein |accession=P05090 |description=Apolipoprotein D |gene=APOD |name=APOD |sequence=MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGR CIQANYSLMENGKIKVLNQELRAD...")