All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

  • 06:06, 7 April 2021 Edwardsnj talk contribs created page P04196 (Created page with "{{Protein |accession=P04196 |description=Histidine-rich glycoprotein |gene=HRG |name=HRG |sequence=MKALIAALLLITLQYSCAVSPTDCSAVEPEAEKALDLINKRRRDGYLFQLLRIADAHLDR VENTTVYYLVLDVQE...")