All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 17:16, 6 April 2021 Edwardsnj talk contribs created page P02790 (Created page with "{{Protein |accession=P02790 |description=Hemopexin |gene=HPX |name=HPX |sequence=MARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATT LDDNGTMLFFKGEFVWKSHKWDRELISERWKNF...")