All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 21:58, 6 April 2021 Edwardsnj talk contribs created page P01876 (Created page with "{{Protein |accession=P01876 |description=Immunoglobulin heavy constant alpha 1 |gene=IGHA1 |name=IGHA1 |sequence=ASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDAS G...")